PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BS_BA396392C.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 367aa    MW: 37713 Da    PI: 8.3997
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BS_BA396392C.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.92e-3794153261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            +e+ lkcprCds+ntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Traes_1BS_BA396392C.2  94 PEQGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 153
                            57899*************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3878152IPR003851Zinc finger, Dof-type
PfamPF027016.9E-3296152IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67798152IPR003851Zinc finger, Dof-type
PROSITE patternPS013610100136IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MIFPPSFLDS SSWNDNQLDF EQHAHHQQVA AASCGGGAGD GGCNNHELLQ PSIMQQGTLA  60
EGGDGGGGGG GQVVGPVKPM SMSERARLAR VPLPEQGLKC PRCDSANTKF CYFNNYSLSQ  120
PRHFCRACRR YWTRGGALRN VPVGGGYRRH AKRAKPKQAA AAAAAGPLAA NGAASGGSTT  180
SSTTSACTTM SNPAPVLPAM LQNGGGGNLS GLLPPLLRLA DFDAMSLGST FSGMGKPSAV  240
DSAAGYYLGG GGGGAVAGLE QWRVQQMQGF PFFQAMADQQ HTLGPAAAPA MAMPGMFHYL  300
GLGNGGDGRG GHEDDGGNQQ FHHAMPSKRE GYPRSGSIAM YGGDHHLAAG AGYTSSYSNA  360
ATGNHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843530.0AM084353.1 Hordeum vulgare subsp. vulgare dof5 gene for dof zinc finger protein 5, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.11e-105PREDICTED: dof zinc finger protein DOF3.6
TrEMBLW5AB060.0W5AB06_WHEAT; Uncharacterized protein
STRINGBGIOSGA018944-PA1e-104(Oryza sativa Indica Group)
STRINGLOC_Os05g02150.11e-104(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-40OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]